Makale yayınlamak için
Üye Ol Üye Girişi Yap

Ücretsiz Web sitesi Tanıtım Yazısı Projesi
Başvuru ve EğitimBilgisayarlarÇevreEv ve AileFinansİletişimİnternetİşKişisel GelişimModaSağlık ve FitnesSanat ve EğlenceSeyahatSiyasetSporToplumUlaşımÜrün YorumlarıSohbetYiyecek ve İçecek

toplam 340 makale ve 309 yorum yazıldı.


YAPILAN SON YORUMLAR
(Usta Elektrikçi) Site gayet hoş olmuş Ama tanıtım yazısındaki linkler h
(seydi) güzel bir site olmuş. tebrikler, oyun oynamak için sabır
(internettenparakazanmak) Türkiyenin yerli ve milli görüş haber sitesi. Gündemin
(Kadınlar) Kadınlar hakkında haftalık burçlar, günlük burçlar, m
(M.Salih ASLAN) Güzel organizasyon aslında hizmetlerde çok güzel duruyor
(internettenparakazanmak) Evet eskiyen dökülen yerleri boyamak yerine bu tür yazıl
(internettenparakazanmak) Evet eskiyen dökülen yerleri boyamak yerine bu tür yazıl
(internettenparakazanmak) Bunlar çikartıldığı zaman kaportaya bir zarar veriyormu
(Tekno Burger) Oooo bayağı bi oyun varmış. Bi ara bakarım aklımızda
(Tekno Burger) Lisanslı yazılım kullanmak "zorundayız". Yazı
Ferrucci Saat
firsatsatislari.com
Moda
214 kez okundu ve 0 kez yorumlandı

www.firsatsatislari.com Web sitemizde ferrucci saatlerine ulaşabilirisiniz. Ferrucci saatlerimiz 2 yıl garantili olup özel kabında sizlere verilicektir. Ferrucci saatleri ucuzdur. Ferrucci For mot
devamını oku

DEV KAMPANYA-IMALATTAN YATAK BAZA BASLIKLAR
kalitist.com
İş
247 kez okundu ve 2 kez yorumlandı

DEV KAMPANYA İMALATTAN SÜNGER ve İŞÇİ YATAKLARI , EKONOMİK ORTOPEDİK ve LUX YAYLI YATAKLAR , SANDIKLI ve OTEL TİPİ ÇELİK BAZALAR , DERİ ve LUX BAŞLIKLAR , ŞANTİYE ve YURT TİPİ RANZA
devamını oku

internetten para kazanma yolları
yazitorstartermoney.blogspot.com.tr
İş
253 kez okundu ve 0 kez yorumlandı

Günümüzde internet sayesinde binlerce iş imkanı ortaya çıktı. Bunlardan biride makale yazarak internetten para kazanma işidir. Web sitelerinin özgün içerik ihtiyacı günden güne artıyor
devamını oku

fal bilim merkezi
telwecafe.com
Başvuru ve Eğitim
248 kez okundu ve 0 kez yorumlandı

FAL BİLİM MERKEZİ www.telwecafe.com İZMİRİN EN ÜNLÜ FALCISIYLA TANIŞMAYA HAZIRMISINIZ FALCI ECEM HANIM İZMİRDE 1 NUMARA TANIŞMAYA HAZIR OLUN TANIDIĞINIZ TÜM FALCILARI UNUTUN SİZ UNUTMAS
devamını oku

Masa Tenisi Kuralları, Masa Tenisi Dersleri, Masa
masa-tenisi.net
Spor
279 kez okundu ve 1 kez yorumlandı

Yeni açılan masa-tenisi.net sitemiz masa tenisi hakkında geniş bilgi veren ve sizlerinde görüşlerinizle büyüyen yeni bir platformdur. Sitemiz, bu spora yeni başlayan kardeşlerimizin tecrüb
devamını oku

İnşaat Firması Scriptleri
hazirscriptler.web.tr/hazir-php-scriptle
İnternet
246 kez okundu ve 0 kez yorumlandı

İnşaat firmaları için hazırladığımız inşaat firma scripti versiyonlarını web sitemizde inceleyiniz. Standart ve mobil uyumlu inşaat firması scripti kategorimizde çok sayıda inşaat scr
devamını oku

Bergama Emlak Sitesi
bergamadakiralik.com
İş
238 kez okundu ve 0 kez yorumlandı

Bergamada Kiralık isimli yeni emlak sitesi Bergamada bulunan müstakil ev, daire, işyeri, dükkan, arsa ve tarla ilanları için yeni bir emlak ilan sitesi olarak yayına başlamış bulunuyor. B
devamını oku

Ankara Nakliyat Firmaları
ankaraevdenevenakliyatfirmalari.com
İş
236 kez okundu ve 0 kez yorumlandı

Ankara ilinde faaliyet gösteren evden eve nakliyat firmaları rehberimizde bölgelere göre listelemiştir. Web sitemizde kayıtlı tüm firmalar Ankara genelinde şehir içi ve yurt genelinde şe
devamını oku

Ücretsiz Script ve Temalar
ucretsiz.script.web.tr
İnternet
238 kez okundu ve 0 kez yorumlandı

Ücretsiz scriptler çoğu zaman hemen kısa sürede hızlıca ve az maliyetle web sitesi hazırlamak için tercih edilmektedir. Sadece bir domain ve hosting satın alarak beğendiğiniz bir ücretsiz
devamını oku

Hazır Emlak Sitesi
haziremlaksitesi.biz.tr
İnternet
238 kez okundu ve 0 kez yorumlandı

Hazır emlak sitesi paketlerimiz, internetin artık neredeyse her eve ve her cebe girdiği dönemde, emlak ofisleri için internette kurumsal görünümün bir gereği olarak hizmete sunulmuştur. Far
devamını oku

Seyahatlerde işinize çok yarayacak püf noktalar
kutubaligi.com
Seyahat
165 kez okundu ve 0 kez yorumlandı

Seyahat fırsatları, ipuçları ve yolcu hakları. Nereye en ucuz nasıl gidilir? En iyi nasıl gezilir? Gezilecek yerler, görülecek şeyler. Ne yenir ne içilir ve daha bir çok püf noktası hep
devamını oku

Hazır Scriptler
hazirscriptler.web.tr
İnternet
249 kez okundu ve 0 kez yorumlandı

Hazır Scriptler genelde en kısa zamanda ve en uygun fiyata web sitesi hazırlamak için tercih edilmektedir. Hazır scriptler PHP veya ASP ile kodlanmış yazılımlardır ve web sitesi hazırlaman
devamını oku

İkinci el eşya alanlar
ikincielesyatr.com/ikinci-el-esya-alanla
Ev ve Aile
211 kez okundu ve 0 kez yorumlandı

İkinci el eşya alanlar istanbul geneli 2.el eşya alım satım merkezi olarak ihtiyacınız olan her türlü ev eşyalarını bütçenize uygun fiyatlarla sizlerin hizmetine sunuyoruz. Ayrıca satma
devamını oku

Doğru Oto Lastik Seçimi
yolyardim.com/2017/05/13/oto-lastik-seci
İş
240 kez okundu ve 0 kez yorumlandı

Oto lastiğin önemi Güvenli bir sürüş deneyimi için araçlarda lastik çok önemlidir. Aracın yol tutuşunu sağlayan en önemli unsur lastiktir. Viraj almada, frenlemede aracın hızını k
devamını oku

Yol Yardım
yolyardim.com/yol-yardim
Ulaşım
216 kez okundu ve 0 kez yorumlandı

Yol Yardım Araç kullanmanın keyfinin yanında yaşadığımız en büyük problemlerin başında arızalar meydana geliyor. Seyahatinizin en güzel anında aniden meydana gelen bir olay canını
devamını oku

internetten para kazanma yolları
internettenpara-kazanma.com
İnternet
255 kez okundu ve 7 kez yorumlandı

İnternet dünyada milyonlarca insanın kullandığı ve aynı platformda bir araya geldiği devasa bir ortak alan haline geldi. Bu sebepledir ki dünya ticari hayatıda artık internet üzerinden dev
devamını oku

Samsun’da Golfün Tadına Varın!
samsungolfsahasi.com
Spor
258 kez okundu ve 0 kez yorumlandı

Samsun golf sahası bulunduran golf kulüpleri bireylere bu sporu öğrenmelerinde yardımcı oluyorlar. Küçük çocuklar için ise çeşitli eğitim programları sunuyorlar. Böylece çocukluktan
devamını oku

Bursa Evden Eve Nakliyat
bursaevdenevetasima.net
Ulaşım
240 kez okundu ve 1 kez yorumlandı

Bursa Evden Eve Nakliyat sektöründe profesyonel ekibi olan deneyimli bir firmayız. Önceliğimiz müşterilerimizin memnuniyeti ve evlerini sorunsuz olarak taşımaktır. Bursa\da Evden Eve Nakliya
devamını oku

DÜNYADAN TÜM ÜRÜNLER EN UCUZA AYAĞINIZA GELS
www.istealgelsin.com
Yiyecek ve İçecek
236 kez okundu ve 5 kez yorumlandı

LİNKTEN BAKABİLİRSİNİZ\\r\\n\\r\\nTESLİMAT BİLGİLERİ \\r\\n\\r\\n\\r\\n\\r\\nTEDARİK SÜRECİ ürün tedarik süreci 1 ile 3 iş günü arasında yapılmaktadır\\r\\n\\r\\nTESLİM EDİLME S
devamını oku

size düşen keyfini çıkarmak
www.banyomega.com
Ev ve Aile
194 kez okundu ve 0 kez yorumlandı

e-ticaret sektöründe türkiyenin ve dünyanın en ünlü markalı banyo malzemelerini satan web sitemiz\\\\\\\'de güvenli bir şekilde alışveriş yapma imkanı sizleri bekliyor.Banyonuzu dekore e
devamını oku

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17